PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G203400.1.p
Common NameSb06g027465, SORBIDRAFT_06g027465
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 379aa    MW: 41030.9 Da    PI: 8.5737
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G203400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.14.1e-25113157145
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Sobic.006G203400.1.p 113 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVEA 157
                           79****************************************986 PP

2QLQ57.93.1e-205893237
                   QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                           FTaaQ ++L++Q+l+yKyL+a++PvPp+Ll+++++
  Sobic.006G203400.1.p 58 LFTAAQYEELEHQALIYKYLVAGVPVPPDLLVPLRR 93
                          6********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-115793IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.6585893IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.4E-145991IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.517113157IPR014977WRC domain
PfamPF088793.8E-21114156IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSSLL PFCRAAPLSA VGEDAAQHHQ QQQQQHTMSG RWAARPALFT  60
AAQYEELEHQ ALIYKYLVAG VPVPPDLLVP LRRGFVYHQP ALGYGTYFGK KVDPEPGRCR  120
RTDGKKWRCS KEAAPDSKYC ERHMHRGRNR SRKPVEAPLV PPPHAPQQQQ QQQQPPPAPV  180
AGFQNHSLYP SVLAGNGGVG VGGGGGGTFG MGPTSQLHMD SAAAYATAAG GGSKDLRYSA  240
YGAKSLSDDH SQLLPGGMDP SMDNSWRLLP SQTTTFQATS YPVFGTLSGL DESTIASLPK  300
TQREPLSFFG SDYVTAKQEN QTLRPFFDEW PKSRESWPEL AEDNHLGFSA TQLSISIPMA  360
TSDFSNTSSR SPNGIPSR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278580.0KJ727858.1 Zea mays clone pUT5949 GRF transcription factor (GRF5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448459.10.0hypothetical protein SORBIDRAFT_06g027465
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLC5YF610.0C5YF61_SORBI; Putative uncharacterized protein Sb06g027465
STRINGSb06g027465.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.19e-34growth-regulating factor 5